Recombinant Human Dkk3 Protein (RMPP-00230757)
Cat. No.: RMPP-00230757
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
2 μg
Product Features
| Source | CHO cells |
|---|---|
| Purity | ≥ 98% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 0.060 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: CHO cells; Purity: ≥ 98% SDS-PAGE; Endotoxin level: < 0.060 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P12643 |
|---|---|
| Sequence | RKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLN STNH AIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQ DMVVEGCGCR |
| Sequence Similarities | Belongs to the TGF-beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Tissue Specificity | Particularlythis product in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine. |
| Function | Induces cartilage and bone formation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C. Constituent: 100% PBS0.2µm-filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
