Recombinant Human FGF8 Protein (Animal Free) (RMPP-00230743)
Cat. No.: RMPP-00230743
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| Molecular Weight | 8 kDa |
|---|---|
| Sequence | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA |
| Protein Length | Full length protein |
| Cellular Localization | Macrophage Inflammatory Protein 1 alpha / CCL3: Secreted. MIP 1 alpha: Secreted. |
Storage & Shipping
| Shipping and Storage | Shipped at room temperature. Store at -20°C. Constituent: 0.1% Trifluoroacetic acid0.2 micron filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
