Recombinant Human FGFR3 Protein (Active) (RMPP-00230100)
Cat. No.: RMPP-00230100
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | P15923 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQ AVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGL SEAHNPAGHM |
| Sequence Similarities | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Domain | the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. |
| Function | Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. |
| Involvement in Disease | Note=Chromosomal aberrations involving TCF3 are cause of forms of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(1;19)(q23;p13.3) with PBX1; Translocation t(17;19)(q22;p13.3) with HLF. Inversion inv(19)(p13;q13) with TFPT. |
| Post-translational Modifications | Phosphorylated following NGF stimulation. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
