Recombinant Human SOX2 Protein (RMPP-00230923)
Cat. No.: RMPP-00230923
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
500 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P02818 |
|---|---|
| Molecular Weight | 31 kDa including tags |
| Sequence | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Sequence Similarities | Belongs to the osteocalcin/matrix Gla protein family. Contains 1 Gla (gamma-carboxy-glutamate) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. |
| Post-translational Modifications | Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
