Banner

Recombinant Human Ihh Protein (RMPP-00230880)

Cat. No.: RMPP-00230880

Category: Growth Factors & Cytokines

Research Area: Immunology

INQUIRY 5 μg Customer Size

Product Features

Source HEK 293 cells
Purity > 95% HPLC.
Nature Recombinant
Endotoxin Level ≤ 0.005 Eu/µg
Carrier Free Yes
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; HPLC; Functional Studies
Key Features Expression system: HEK 293 cells; Purity: > 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, MS, HPLC, Functional Studies

Protein Information

UniProt ID P01584
Molecular Weight 31 kDa
Sequence ATVPELNCEIAAFDSEENDLFFEADRPQKIKDCFQALDLGCPDESIQLQI SQQHLDKSFRKAVSLIVAVEKLWQLPMSCPWSFQDEDPSTFFSFIFEEEP VLCDSWDDDDLLVCDVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQN ISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESV DPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLG NSNGRDIVDFTMEPVSS
Sequence Similarities Belongs to the IL-1 family.
Protein Length Full length protein
Cellular Localization Cytoplasm, cytosol. Lysosome. Secreted, exosome. Cytoplasmic vesicle, autophagosome. Secreted. The precursor is cytosolic. In response to inflammasome-activating signals, such as ATP for NLRP3 inflammasome or bacterial flagellin for NLRC4 inflammasome, cleaved and secreted. IL1B lacks any known signal sequence and the pathway(s) of its secretion is(are) not yet fully understood. On the basis of experimental results, several unconventional secretion mechanisms have been proposed. 1. Secretion via secretory lysosomes: a fraction of CASP1 and IL1B precursor may be incorporated, by a yet undefined mechanism, into secretory lysosomes that undergo Ca(2+)-dependent exocytosis with release of mature IL1B. 2. Secretory autophagy: IL1B-containing autophagosomes may fuse with endosomes or multivesicular bodies (MVBs) and then merge with the plasma membrane releasing soluble IL1B or IL1B-containing exosomes. However, autophagy impacts IL1B production at several levels and its role in secretion is still controversial. 3. Secretion via exosomes: ATP-activation of P2RX7 leads to the formation of MVBs containing exosomes with entrapped IL1B, CASP1 and other inflammasome components. These MVBs undergo exocytosis with the release of exosomes. The release of soluble IL1B occurs after the lysis of exosome membranes (By similarity). 4. Secretion by microvesicle shedding: activation of the ATP receptor P2RX7 may induce an immediate shedding of membrane-derived microvesicles containing IL1B and possibly inflammasome components. The cytokine is then released in the extracellular compartment after microvesicle lysis. 5. Release by translocation through permeabilized plasma membrane. This may occur in cells undergoing pyroptosis due to sustained activation of the inflammasome (By similarity). These mechanisms may not be not mutually exclusive.
Tissue Specificity Expressed in activated monocytes/macrophages (at protein level).
Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
Post-translational Modifications Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.