Recombinant Human IL-1R-2 Protein (RMPP-00230539)
Cat. No.: RMPP-00230539
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 80% Purified via His tag. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | MS; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 80% Purified via His tag; Tags: His tag N-Terminus; Suitable for: MS, SDS-PAGE |
Protein Information
| UniProt ID | P27348 |
|---|---|
| Molecular Weight | 31 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTELIQKAKLAEQA ERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIE QKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKV FYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTL IMQLLRDNLTLWTSDSAGEECDAAEGAEN |
| Sequence Similarities | Belongs to the 14-3-3 family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. In neurons, axonally transported to the nerve terminals. |
| Tissue Specificity | Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression in individuals with predominant lower motor neuron involvement. |
| Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. |
| Post-translational Modifications | Ser-232 is probably phosphorylated by CK1. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles. pH: 7.50Constituents: 0.012% Benzamidine, 0.004% PMSF, 0.02% DTT, 0.6% HEPES, 50% Glycerol |
|---|
For research use only. Not for clinical use.
