Recombinant Human IL-4 Protein (RMPP-00230130)
Cat. No.: RMPP-00230130
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
20 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; WB |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB |
Protein Information
| UniProt ID | P02786 |
|---|---|
| Sequence | YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFP AARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLAL Y |
| Sequence Similarities | Belongs to the peptidase M28 family. M28B subfamily. Contains 1 PA (protease associated) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. |
| Function | Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake.(Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus. |
| Involvement in Disease | Immunodeficiency 46 |
| Post-translational Modifications | N- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
