Recombinant Human IL-6R Protein (RMPP-00230262)
Cat. No.: RMPP-00230262
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. Produced using animal-free processes and contains only animal-free raw materials. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P05112 |
|---|---|
| Molecular Weight | 13 kDa |
| Sequence | MHNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAA TVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKV IMQKKYYRH |
| Sequence Similarities | Belongs to the IL-4/IL-13 family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. |
| Involvement in Disease | Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile (0.2 micron) filtered aqueous solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
