Recombinant Human Interferon gamma Protein (Active) (RMPP-00230158)
Cat. No.: RMPP-00230158
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
10 μg
250 µg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | Functional Studies; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: Functional Studies, Cell Culture, SDS-PAGE, HPLC, MS |
Protein Information
| UniProt ID | P26441 |
|---|---|
| Molecular Weight | 23 kDa |
| Molecular Weight Information | Predicted MW is 22856.99 Da (+/- 10 Da by ESI-TOF). Observed MW is 22858.40 Da |
| Sequence | AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLD SADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPT EGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Sequence Similarities | Belongs to the CNTF family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. |
| Tissue Specificity | Nervous system. |
| Function | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
