Recombinant Human LEF1 Protein (RMPP-00230374)
Cat. No.: RMPP-00230374
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. NULL |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P04085 |
|---|---|
| Molecular Weight | 24 kDa |
| Sequence | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLN PDYREEDTGRPRESGKKRKRKRLKPT |
| Sequence Similarities | Belongs to the PDGF/VEGF growth factor family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Domain | The long form contains a basic insert which acts as a cell retention signal. |
| Function | Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.. Constituent: 0.1% Trifluoroacetic acidLyophilized from. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
