Recombinant Human LipoProtein lipase (RMPP-00230875)
Cat. No.: RMPP-00230875
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q9BS40 |
|---|---|
| Molecular Weight | 28 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGT PHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYP QMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFG NVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIE LDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE |
| Sequence Similarities | Belongs to the protease inhibitor I47 (latexin) family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. |
| Tissue Specificity | Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain. |
| Function | Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 69% PBS, 0.02% DTT, 30% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
