Recombinant Human Osteocrin Protein (RMPP-00230864)
Cat. No.: RMPP-00230864
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 85% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 85% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | P46695 |
|---|---|
| Molecular Weight | 11 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMCHSRSCHPTMTILQAPTPAPSTIPGP RRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPV EEPNP |
| Sequence Similarities | Belongs to the IER3 family. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment. |
| Post-translational Modifications | Phosphorylated at Thr-18, Thr-123 and Ser-126 by MAPK1/ERK2 and probably MAPK3/ERK1. Upon phosphorylation by MAPK1/ERK2 and MAPK3/ERK1, acquires the ability to inhibit cell death induced by various stimuli.Glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride |
|---|
For research use only. Not for clinical use.
