Recombinant Human Notch2 Protein

Products

Online Inquiry

Recombinant Human Notch2 Protein (RMPP-00230357)

Cat. No.: RMPP-00230357

Category: Recombinant Protein

Research Area: Cardiovascular

INQUIRY 10 μg Customer Size

Product Features

Source	HEK 293 cells
Purity	> 95% SDS-PAGE.
Nature	Recombinant
Endotoxin Level	< 1.000 Eu/µg
Animal Free	No
Tags	Fc tag C-Terminus
Form	Lyophilized
Applications	Functional Studies; SDS-PAGE
Key Features	Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID	P16284
Molecular Weight	91 kDa including tags
Molecular Weight Information	The protein migrates as 105-130 kDa under reducing condition due to glycosylation.
Sequence	QENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYK DDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLV EGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKL KREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELV TVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKA IVAHNRHGNKAVYSVMAMVEHSGNYTCKVESSRISKVSSIVVNITELFSK PELESSFTHLDQGERLNLSCSIPGAPPANFTIQKEDTIVSQTQDFTKIAS KSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTI EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCV ADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNE GSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNR ANHASSVPRSKILTVRVILAPWKK
Sequence Similarities	Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
Protein Length	Protein fragment
Cellular Localization	Membrane. Cell junction. Localizes to the lateral border recycling compartment (LBRC) and recycles from the LBRC to the junction in resting endothelial cells and Cell junction. Localizes to the lateral border recycling compartment (LBRC) and recycles from the LBRC to the junction in resting endothelial cells.
Tissue Specificity	Expressed on platelets and leukocytes and is primarily concentrated at the borders between endothelial cells. Isoform Long predominates in all tissues examined. Isoform Delta12 is detected only in trachea. Isoform Delta14-15 is only detected in lung. Isoform Delta14 is detected in all tissues examined with the strongest expression in heart. Isoform Delta15 is expressed in brain, testis, ovary, cell surface of platelets, human umbilical vein endothelial cells (HUVECs), Jurkat T-cell leukemia, human erythroleukemia (HEL) and U937 histiocytic lymphoma cell lines (at protein level).
Domain	The Ig-like C2-type domains 2 and 3 contribute to formation of the complex with BDKRB2 and in regulation of its activity.
Function	Induces susceptibility to atherosclerosis (By similarity). Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions. Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC) and is also essential for the LBRC membrane to be targeted around migrating leukocytes. Prevents phagocyte ingestion of closely apposed viable cells by transmitting 'detachment' signals, and changes function on apoptosis, promoting tethering of dying cells to phagocytes (the encounter of a viable cell with a phagocyte via the homophilic interaction of PECAM1 on both cell surfaces leads to the viable cell's active repulsion from the phagocyte. During apoptosis, the inside-out signaling of PECAM1 is somehow disabled so that the apoptotic cell does not actively reject the phagocyte anymore. The lack of this repulsion signal together with the interaction of the eat-me signals and their respective receptors causes the attachment of the apoptotic cell to the phagocyte, thus triggering the process of engulfment). Isoform Delta15 is unable to protect against apoptosis. Modulates BDKRB2 activation. Regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in human umbilical cord vein cells (HUVEC).
Post-translational Modifications	Phosphorylated on Ser and Tyr residues after cellular activation. In endothelial cells Fyn mediates mechanical-force (stretch or pull) induced tyrosine phosphorylation.

Storage & Shipping

Shipping and Storage	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris, Sodium chloride, L-ArginineLyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution.

Shipping and Storage

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris, Sodium chloride, L-ArginineLyophilized from 0.22 µm filtered solution.
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.