Recombinant Human PDGFAA + PDGFBB Protein

Products

Online Inquiry

Recombinant Human PDGFAA + PDGFBB Protein (RMPP-00230552)

Cat. No.: RMPP-00230552

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 10 μg 1 mg

Product Features

Source	HEK 293 cells
Purity	> 95% SDS-PAGE.
Nature	Recombinant
Endotoxin Level	< 1.000 Eu/µg
Animal Free	No
Form	Lyophilized
Applications	SDS-PAGE
Key Features	Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE

Protein Information

UniProt ID	P01730
Molecular Weight	67 kDa including tags
Sequence	KKVVLGKKGDTVELTCNASQKKNTQFHWKNSNQIKILGIQGSFLTKGPSK LSDRADSRKSLWDQGCFSMIIKNLKIEDSDTYICEVENKKEEVELLVFGL TANSDTHLLEGQSLTLTLESPPGSSPSVKCRSPGGKNIQGGRTLSVPQLE RQDSGTWTCTVSQDQKTVEFKIDIVVLAFQKASSTVYKKEGEQVEFSFPP AFTLEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQFQEN LTCEVWGPTSPKLTLSLKLENKGTTVSKQAKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVVPTW
Sequence Similarities	Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Protein Length	Protein fragment
Cellular Localization	Cell membrane. Localizes to lipid rafts. Removed from plasma membrane by HIV-1 Nef protein that increases clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Cell surface expression is also down-modulated by HIV-1 Envelope polyprotein gp160 that interacts with, and sequesters CD4 in the endoplasmic reticulum.
Function	Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
Post-translational Modifications	Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.

Storage & Shipping

Shipping and Storage	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section. pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 0.06% Sodium chloride, L-Arginine5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution.

Shipping and Storage

Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 0.06% Sodium chloride, L-Arginine5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.