Recombinant Human TIE2 (mutated L914F) Protein (Active) (RMPP-00230708)
Cat. No.: RMPP-00230708
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | ≥ 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P49771 |
|---|---|
| Molecular Weight | 17 kDa |
| Sequence | MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWR LVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQA NISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALE ATSLP |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Constituent: 0.16% Sodium phosphate This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
