Recombinant Human S100 beta Protein (RMPP-00231000)
Cat. No.: RMPP-00231000
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 93% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; Functional Studies; MS |
| Key Features | Expression system: E.coli; Purity: > 93% SDS-PAGE; Endotoxin level: = 5.000 Eu/µg; Active: Yes; Suitable for: WB, Functional Studies, SDS-PAGE, MS |
Protein Information
| UniProt ID | P01106 |
|---|---|
| Molecular Weight | 53 kDa |
| Sequence | MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCAESGGGGSPGRRRRRRRRRRR |
| Sequence Similarities | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus > nucleoplasm. Nucleus > nucleolus. |
| Function | Participates in the regulation of gene transcription. Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CACTG-3'. Seems to activate the transcription of growth-related genes. |
| Involvement in Disease | Note=Overexpression of MYC is implicated in the etiology of a variety of hematopoietic tumors.Note=A chromosomal aberration involving MYC may be a cause of a form of B-cell chronic lymphocytic leukemia. Translocation t(8;12)(q24;q22) with BTG1.Defects in MYC are a cause of Burkitt lymphoma (BL). A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass. Note=Chromosomal aberrations involving MYC are usually found in Burkitt lymphoma. Translocations t(8;14), t(8;22) or t(2;8) which juxtapose MYC to one of the heavy or light chain immunoglobulin gene loci. |
| Post-translational Modifications | Phosphorylated by PRKDC. Phosphorylation at Thr-58 and Ser-62 by GSK3 is required for ubiquitination and degradation by the proteasome.Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-58 and Ser-62, leading to its degradation by the proteasome. In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation. In the nucleolus, however, ubiquitination is not counteracted by USP28, due to the lack of interaction between isoform 4 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus. Also polyubiquitinated by the DCX(TRUSS) complex. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. pH: 7.50Constituent: 0.24% TrisProprietary formulation of NaCl, KCl, CaCl2, MgCl2, Arginine, DTT and glycerol. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
