Recombinant Human Stanniocalcin 2/STC-2 Protein (RMPP-00230922)
Cat. No.: RMPP-00230922
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P52945 |
|---|---|
| Molecular Weight | 58 kDa including tags |
| Sequence | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF PGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPF PEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPP AAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR |
| Sequence Similarities | Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). |
| Domain | The Antp-type hexapeptide mediates heterodimerization with PBX on a regulatory element of the somatostatin promoter.The homeodomain, which contains the nuclear localization signal, not only mediates DNA-binding, but also acts as a protein-protein interaction domain for TCF3(E47), NEUROD1 and HMG-I(Y). |
| Function | Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. Binds preferentially the DNA motif 5'-TAAT-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell. |
| Involvement in Disease | Defects in PDX1 are a cause of pancreatic agenesis (PAC). This autosomal recessive disorder is characterized by absence or hypoplasia of pancreas, leading to early-onset insulin-dependent diabetes mellitus. This was found in a frameshift mutation that produces a truncated protein and results in a second initiation that produces a second protein that act as a dominant negative mutant.Defects in PDX1 are a cause of non-insulin-dependent diabetes mellitus (NIDDM); also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance.Defects in PDX1 are the cause of maturity-onset diabetes of the young type 4 (MODY4); also symbolized MODY-4. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Post-translational Modifications | Phosphorylated by the SAPK2 pathway at high intracellular glucose concentration. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
