Recombinant Human TIE2 (mutated R849W) Protein (Active) (RMPP-00230706)
Cat. No.: RMPP-00230706
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
10 μg
5 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q07011 |
|---|---|
| Molecular Weight | 19 kDa including tags |
| Sequence | VQGPCANCPAGTFCGKSRNPIFVPCPPNSLSCGSGQRTCVLCRRCEGVFR TKKPCSPTSDTECECIAGFHCLGPGCSMCEQDCEQGQEFTKEGCKDCPFG SFNNQKGGICQPWTNCSGGRPVLVNGTKDSDVVCGPTAPGFSPGASSTTS PPPPPAGHSPQVI |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on the surface of activated T-cells. |
| Function | Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: PBS, 5% Trehalose0.22 µm filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
