Recombinant Human CD62E Protein (RMPP-00230457)
Cat. No.: RMPP-00230457
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
200 μg
Customer Size
Product Features
| Source | Mammalian |
|---|---|
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | Yes |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | Functional Studies; WB |
| Key Features | Expression system: Mammalian; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, WB |
Protein Information
| UniProt ID | P11836 |
|---|---|
| Molecular Weight | 34 kDa including tags |
| Molecular Weight Information | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Sequence | MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESK TLGAVQIMNGLFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSL LAAADKNPRKSLVKGKMIMNSLSLFAAISGIIFLIMDIFNITISHFFKME NLNLIKAPMPYVDIHNCDPANPSEKNSLSIQYCGSIRSVFLGVFAVMLIF AFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVEL TEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP |
| Sequence Similarities | Belongs to the MS4A family. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on B-cells. |
| Function | This protein may be involved in the regulation of B-cell activation and proliferation. |
| Involvement in Disease | Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5); also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. |
| Post-translational Modifications | Phosphorylated. Might be functionally regulated by protein kinase(s). |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.14% PBS, 6% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
