Recombinant Human TIE2 (mutated Y897H + R915C) Protein (Active) (RMPP-00230702)
Cat. No.: RMPP-00230702
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Lyophilized from 0. 22 µm filtered solution. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q99062 |
|---|---|
| Molecular Weight | 69 kDa including tags |
| Sequence | ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGR QQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPA IPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSI LDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDV VKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQR GEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPS LELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVPLEEDSGRIQGYVVS WRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPTPVVF SESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSN KTWRMEQNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQE MAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSF SAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTP |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 2 subfamily. Contains 5 fibronectin type-III domains. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Tissue Specificity | One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly expressed in placenta. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation. |
| Function | Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface. |
| Involvement in Disease | Hereditary neutrophilia |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% Trehalose5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
