Recombinant Human VEGFA Protein (RMPP-00231055)
Cat. No.: RMPP-00231055
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
10 μg
2 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes |
Protein Information
| UniProt ID | Q6FHJ7 |
|---|---|
| Molecular Weight | 40 kDa |
| Sequence | VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVN CSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHS WPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDV DCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVV DVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLL ENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKG KPPAPKPASPKKNIKTRSAQKRTNPKRV |
| Sequence Similarities | Belongs to the secreted frizzled-related protein (sFRP) family. Contains 1 FZ (frizzled) domain. Contains 1 NTR domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. Cytoplasmic in ovarian tumor cells. |
| Tissue Specificity | Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, expression levels are inversely correlated with expression of CTNNB1 (at protein level). |
| Domain | The FZ domain is involved in binding with Wnt ligands. |
| Function | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP4 may act as a regulator of adult uterine morphology and function. Increases apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
