Recombinant Human Wnt9a Protein (RMPP-00230684)
Cat. No.: RMPP-00230684
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
2 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 92% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 92% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q07011 |
|---|---|
| Molecular Weight | 19 kDa |
| Sequence | LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFK TRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSAT PPAPAREPGHSPQ |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on the surface of activated T-cells. |
| Function | Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% TrehaloseLyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
