Recombinant Mouse FGF 23 Protein (RMPP-00230977)
Cat. No.: RMPP-00230977
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
20 μg
5 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | Q93097 |
|---|---|
| Molecular Weight | 70 kDa including tags |
| Sequence | MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL TLPARVDTSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGA REWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGV VHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAK AFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRT CWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT |
| Sequence Similarities | Belongs to the Wnt family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted > extracellular space > extracellular matrix. |
| Tissue Specificity | Isoform 1 is expressed in adult heart, brain, placenta, lung, prostate, testis, ovary, small intestine and colon. In the adult brain, it is mainly found in the caudate nucleus, subthalamic nucleus and thalamus. Also detected in fetal brain, lung and kidney. Isoform 2 is expressed in fetal brain, fetal lung, fetal kidney, caudate nucleus, testis and cancer cell lines. |
| Function | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
