Recombinant Mouse IL-6 Protein (Active) (RMPP-00230658)
Cat. No.: RMPP-00230658
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
100 μg
Customer Size
Product Features
| Source | Insect cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Insect cells; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| Molecular Weight | 49 kDa |
|---|---|
| Sequence | APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYA WKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAIS GLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLR GKLKLYTGEVCRRGDR |
| Protein Length | Full length protein |
| Cellular Localization | Secreted |
| Relevance | Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. pH: 7.4Constituent: 100% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
