Recombinant Mouse IL-6 Protein (Active) (RMPP-00230660)
Cat. No.: RMPP-00230660
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | ≥ 96% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: ≥ 96% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q92793 |
|---|---|
| Molecular Weight | 41 kDa including tags |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSRKKIFKPEELRQALMPTLE ALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE PWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
| Sequence Similarities | Contains 1 bromo domain. Contains 1 KIX domain. Contains 2 TAZ-type zinc fingers. Contains 1 ZZ-type zinc finger. |
| Protein Length | Protein fragment |
| Cellular Localization | Cytoplasm. Nucleus. Recruited to nuclear bodies by SS18L1/CREST. In the presence of ALX1 relocalizes from the cytoplasm to the nucleus. |
| Domain | The KIX domain mediates binding to HIV-1 Tat. |
| Function | Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like NCOA3 coactivator. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1 in the presence of EP300. |
| Involvement in Disease | Note=Chromosomal aberrations involving CREBBP may be a cause of acute myeloid leukemias. Translocation t(8;16)(p11;p13) with MYST3/MOZ; translocation t(11;16)(q23;p13.3) with MLL/HRX; translocation t(10;16)(q22;p13) with MYST4/MORF. MYST3-CREBBP may induce leukemia by inhibiting RUNX1-mediated transcription.Defects in CREBBP are a cause of Rubinstein-Taybi syndrome type 1 (RSTS1). RSTS1 is an autosomal dominant disorder characterized by craniofacial abnormalities, broad thumbs, broad big toes, mental retardation and a propensity for development of malignancies. |
| Post-translational Modifications | Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response.Phosphorylated upon DNA damage, probably by ATM or ATR.Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.04% Tween, 20% Glycerol (glycerin, glycerine), 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
