Recombinant rhesus Monkey CD4 Protein (His tag) (RMPP-00230066)
Cat. No.: RMPP-00230066
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: ELISA, SDS-PAGE |
Protein Information
| Sequence | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVI TIKSESTFKN TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKW DGKSTTIKRKREDDKLVVECVM KGVTSTRVYERA |
|---|---|
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasmic |
| Relevance | ALBP is a fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that the role of these proteins includes fatty acid uptake, transport, and metabolism. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Constituent: 50% GlycerolBuffered with Tris or PBS. |
|---|
For research use only. Not for clinical use.
