Recombinant Mouse Interferon gamma Protein (Active) (RMPP-00230086)
Cat. No.: RMPP-00230086
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | O43294 |
|---|---|
| Molecular Weight | 75 kDa including tags |
| Sequence | MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPR SPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPS SKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSD FRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSR RGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFF EKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCG EPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCV SALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG |
| Sequence Similarities | Belongs to the paxillin family. Contains 4 LIM zinc-binding domains. |
| Protein Length | Full length protein |
| Cellular Localization | Cell junction > focal adhesion. Nucleus matrix. Cytoplasm > cytoskeleton. Associated with the actin cytoskeleton; colocalizes with stress fibers. |
| Tissue Specificity | Expressed in platelets, smooth muscle and prostate stromal cells (at protein level). |
| Domain | The LIM zinc-binding domains mediate glucocorticoid receptor coactivation and interaction with AR, CRIP2, ILK, LIMS1, NR3C1, PPARG, TCF3, TCF7L2, SLC6A3 and SMAD3. The LIM zinc-binding 2 and LIM zinc-binding 3 domains mediate targeting to focal adhesions and actin stress fibers. The LIM zinc-binding 3 and LIM zinc-binding 4 domains mediate interaction with TRAF4 and MAPK15. The LIM zinc-binding 4 domain mediates interaction with HSPB1, homooligomerization and targeting to the nuclear matrix. The LIM zinc-binding 3 domain mediates interaction with PTPN12.The LD (leucine and aspartate-rich) motif 3 mediates interaction with GIT1 and functions as a nuclear export signal. |
| Function | Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA-binding activity. |
| Post-translational Modifications | Phosphorylated by gonadotropin-releasing hormone-activated SRC. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.79% Tris HCl, 0.31% Glutathione |
|---|
For research use only. Not for clinical use.
