Recombinant Mouse Thrombopoietin Protein (Animal Free) (RMPP-00230954)
Cat. No.: RMPP-00230954
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
2 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | Q9H772 |
|---|---|
| Sequence | MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIK EVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCCGQ CNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQ KVKQCRCMSVNLSDSDKQ |
| Sequence Similarities | Belongs to the DAN family. Contains 1 CTCK (C-terminal cystine knot-like) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Cytokine that inhibits the activity of BMP2 and BMP4 in a dose-dependent manner. Antagonized BMP4-induced suppression of progesterone production in granulosa cells. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
