Recombinant Mouse VEGF Receptor 2 Protein (RMPP-00230646)
Cat. No.: RMPP-00230646
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
20 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | 90% SDS-PAGE. Purity 90% Glypican 3 and 2-8% human IgG1 Fc fragment as determined by SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P51654 |
|---|---|
| Molecular Weight | 88 kDa including tags |
| Sequence | QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCS RKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKN YTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSL FPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQ VTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPC GGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLF STIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLK VAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWN GQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLR TMSVPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMMKVKNQLRFLA ELAYDLDVDDVPGNNQQATPKDNEISTFHNLGNVH |
| Sequence Similarities | Belongs to the glypican family. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane and Secreted > extracellular space. |
| Tissue Specificity | Highly expressed in lung, liver and kidney. |
| Function | Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition. |
| Involvement in Disease | Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1); also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% TrehaloseLyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
