Recombinant Mouse VEGFA Protein (Active) (RMPP-00230282)
Cat. No.: RMPP-00230282
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
20 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 80% SDS-PAGE. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 80% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | Q969S8 |
|---|---|
| Molecular Weight | 71 kDa |
| Molecular Weight Information | SDS-PAGE molecular weght: ~77kDa |
| Sequence | MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRL SAREASEEELGLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTF HCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAAANGFCVFNNV AIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHG RFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLA FEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLD QPCLCPAPSVRTAVALTTPDITLVLPPDVIQQEASALREETEAWARPHES LAREEALTALGKLLYLLDGMLDGQVNSGIAAT |
| Sequence Similarities | Belongs to the histone deacetylase family. HD type 2 subfamily. |
| Protein Length | Protein fragment |
| Cellular Localization | Cytoplasm. Nucleus. Excluded from the nucleoli. |
| Tissue Specificity | Ubiquitous. High expression in liver, spleen, pancreas and kidney. |
| Function | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
