Recombinant rat CTLA4 Protein (Fc Chimera) (RMPP-00230856)
Cat. No.: RMPP-00230856
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q9NSA3 |
|---|---|
| Molecular Weight | 11 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMG SNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR Q |
| Sequence Similarities | Belongs to the CTNNBIP1 family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Nucleus. |
| Function | Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. pH: 8.00Constituents: 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride |
|---|
For research use only. Not for clinical use.
