Recombinant rat G-CSF Protein (RMPP-00230945)
Cat. No.: RMPP-00230945
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
10 μg
2 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | O14529 |
|---|---|
| Sequence | FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGK ALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE |
| Sequence Similarities | Belongs to the CUT homeobox family. Contains 3 CUT DNA-binding domains. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Function | May be a transcription factor involved in neural specification. Binds to DNA in a sequence-specific manner. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
