Recombinant rat Interferon gamma Protein (Active) (RMPP-00230075)
Cat. No.: RMPP-00230075
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
100 μg
50 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | P21291 |
|---|---|
| Molecular Weight | 47 kDa including tags |
| Sequence | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVA VHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRP TTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCG KGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
| Sequence Similarities | Contains 2 LIM zinc-binding domains. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Function | Could play a role in neuronal development. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
