Recombinant rhesus Monkey IL-1 alpha Protein (Active) (RMPP-00230851)
Cat. No.: RMPP-00230851
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q08117 |
|---|---|
| Molecular Weight | 24 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIK DEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAE IVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAH QLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDK NGHDGDTHQEDDGEKSD |
| Sequence Similarities | Belongs to the WD repeat Groucho/TLE family. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver. |
| Domain | Lacks the C-terminal WD repeats. |
| Function | Transcriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development. |
| Post-translational Modifications | Ubiquitinated by XIAP/BIRC4. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
