Native Cow Single Alpha Chain Collagen Type 1 (RMPP-00230531)
Cat. No.: RMPP-00230531
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
1 ml
5 ml
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | No |
| Form | Lyophilized |
| Applications | MS; HPLC; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Suitable for: MS, HPLC, SDS-PAGE |
Protein Information
| UniProt ID | P02751 |
|---|---|
| Molecular Weight | 23 kDa |
| Molecular Weight Information | Predicted MW is 23280.62 (+/- 10Da by ESI-TOF). MW observed is 23281.76. |
| Sequence | IGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSEYIIS CHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVRE EVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQC LGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGE FKCDPHEATC |
| Sequence Similarities | Contains 12 fibronectin type-I domains. Contains 2 fibronectin type-II domains. Contains 16 fibronectin type-III domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. |
| Tissue Specificity | Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine. |
| Developmental Stage | Ugl-Y1, Ugl-Y2 and Ugl-Y3 are present in the urine from 0 to 17 years of age. |
| Function | Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling. |
| Involvement in Disease | Glomerulopathy with fibronectin deposits 2 |
| Post-translational Modifications | Sulfated.It is not known whether both or only one of Thr-2064 and Thr-2065 are/is glycosylated.Forms covalent cross-links mediated by a transglutaminase, such as F13A or TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers (e.g. fibrinogen-fibronectin, collagen-fibronectin heteropolymers).Phosphorylated by FAM20C in the extracellular medium.Proteolytic processing produces the C-terminal NC1 peptide, anastellin. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose |
|---|
For research use only. Not for clinical use.
