Recombinant Cow Prion Protein PrP (RMPP-00230814)
Cat. No.: RMPP-00230814
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. > 95% by HPLC. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, HPLC, Functional Studies |
Protein Information
| UniProt ID | O76093 |
|---|---|
| Molecular Weight | 21 kDa |
| Sequence | EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARG EDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKEC VFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKR YPKGQTELQKPFKYTTVTKRSRRIRPTHPG |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40Constituents: 97% PBS, 2.92% Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
