Recombinant Human Activin Receptor Type IA (mutated R258G) Protein (Active) (RMPP-00230506)
Cat. No.: RMPP-00230506
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. Purity is determined by SDS-PAGE and HPLC analyses. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P09341 |
|---|---|
| Molecular Weight | 8 kDa |
| Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
| Post-translational Modifications | N-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 99% Phosphate Buffer, 0.87% Sodium chlorideLyophilized from a 0.2 µM filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
