Recombinant Human BAFF-R Protein (RMPP-00230799)
Cat. No.: RMPP-00230799
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, HPLC |
Protein Information
| UniProt ID | P80370 |
|---|---|
| Molecular Weight | 30 kDa including tags |
| Sequence | AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQ CICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKD CQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANS CTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTC LQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVH ELPVQQPEHRILKVSMKELNKKTPVDHHHHHH |
| Sequence Similarities | Contains 6 EGF-like domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue. |
| Function | May have a role in neuroendocrine differentiation. |
| Post-translational Modifications | N- and O-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. pH: 7.4Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride |
|---|
For research use only. Not for clinical use.
