Banner

Recombinant Human c-Kit (mutated D820Y) Protein

Recombinant Human c-Kit (mutated D820Y) Protein (RMPP-00230478)

Cat. No.: RMPP-00230478

Category: Growth Factors & Cytokines

Research Area: Cardiovascular

INQUIRY 10 μg 5 μg

Product Features

Source E.coli
Purity > 98% SDS-PAGE. > 98% by HPLC analysis.
Nature Recombinant
Animal Free Yes
Form Lyophilized
Applications HPLC; Functional Studies; SDS-PAGE
Key Features Expression system: E.coli; Purity: > 98% SDS-PAGE; Active: Yes; Suitable for: HPLC, Functional Studies, SDS-PAGE

Protein Information

UniProt ID P15692
Molecular Weight 38 kDa
Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
Sequence Similarities Belongs to the PDGF/VEGF growth factor family.
Protein Length Full length protein
Cellular Localization Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
Tissue Specificity Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
Function Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
Involvement in Disease Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.