Recombinant Human CD2 Protein (Tagged) (RMPP-00230786)
Cat. No.: RMPP-00230786
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Purity by HPLC ≥95%. |
| Nature | Recombinant |
| Endotoxin Level | < 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS; Cell Culture |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC, MS, Cell Culture |
Protein Information
| UniProt ID | P01127 |
|---|---|
| Molecular Weight | 12 kDa |
| Molecular Weight Information | M + 0.41 Da (Calc. mass 12351.59 Da). |
| Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS GCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE TVAAARPVT |
| Protein Length | Full length protein |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
