Recombinant Human CD32 Protein (RMPP-00230779)
Cat. No.: RMPP-00230779
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
20 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P13232 |
|---|---|
| Molecular Weight | 15 kDa |
| Sequence | DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTK EAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIK EQKKNDPCFLKRLLREIKTCWNKILKGSI |
| Sequence Similarities | Belongs to the IL-7/IL-9 family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions. pH: 7.40Constituent: 100% PBSLyophilized from a 0.2 µM filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
