Recombinant Human p75 NGF Receptor Protein (RMPP-00230829)
Cat. No.: RMPP-00230829
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. =95% by HPLC |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, HPLC, MS, Functional Studies |
Protein Information
| UniProt ID | P60568 |
|---|---|
| Molecular Weight | 16 kDa |
| Sequence | APTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMMLTFKFYLPKQA TELKHLQCLENELGALQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLKGS ENKFECQFDDEPATVVEFLRRWIAICQSIISTMTQ |
| Sequence Similarities | Belongs to the IL-2 family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
| Involvement in Disease | Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.