Recombinant Human CD70 Protein (RMPP-00230770)
Cat. No.: RMPP-00230770
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 96% SDS-PAGE. >96% as determined by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 96% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | Q14623 |
|---|---|
| Molecular Weight | 20 kDa |
| Sequence | IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSE RFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVK LRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFD WVYYESKAHVHCSVKSEHSAAAKTGG |
| Sequence Similarities | Belongs to the hedgehog family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space. The C-terminal peptide diffuses from the cell and Cell membrane. The N-terminal peptide remains associated with the cell surface. |
| Tissue Specificity | Expressed in embryonic lung, and in adult kidney and liver. |
| Function | Intercellular signal essential for a variety of patterning events during development. Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones. Induces the expression of parathyroid hormone-related protein (PTHRP). |
| Involvement in Disease | Defects in IHH are the cause of brachydactyly type A1 (BDA1). BDA1 is an autosomal dominant disorder characterized by middle phalanges of all the digits rudimentary or fused with the terminal phalanges. The proximal phalanges of the thumbs and big toes are short.Defects in IHH are a cause of acrocapitofemoral dysplasia (ACFD). ACFD is a disorder characterized by short stature of variable severity with postnatal onset. The most constant radiographic abnormalities are observed in the tubular bones of the hands and in the proximal part of the femur. Cone-shaped epiphyses or a similar epiphyseal configuration with premature epimetaphyseal fusion result in shortening of the skeletal components involved. Cone-shaped epiphyses were also present to a variable extent at the shoulders, knees, and ankles. |
| Post-translational Modifications | The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity.Cholesterylation is required for N-product targeting to lipid rafts and multimerization.Palmitoylated. N-palmitoylation is required for N-product multimerization and full activity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituents: Phosphate Buffer, 0.87% Sodium chloride0.2 µm filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
