Native Cow Acid Soluble Collagen Type 1 (RMPP-00230533)
Cat. No.: RMPP-00230533
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
1 ml
5 ml
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | MS; HPLC; SDS-PAGE; Cell Culture; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: MS, HPLC, SDS-PAGE, Cell Culture, Functional Studies |
Protein Information
| UniProt ID | P01133 |
|---|---|
| Molecular Weight | 6 kDa |
| Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR |
| Sequence Similarities | Contains 9 EGF-like domains. Contains 9 LDL-receptor class B repeats. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in kidney, salivary gland, cerebrum and prostate. |
| Function | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. |
| Involvement in Disease | Hypomagnesemia 4 |
| Post-translational Modifications | O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor). |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
