Recombinant Human FGFR4 (mutated V550L) Protein (Active) (RMPP-00230616)
Cat. No.: RMPP-00230616
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Biological Activity; ELISA; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Biological Activity, ELISA, Functional Studies |
Protein Information
| UniProt ID | P14784 |
|---|---|
| Molecular Weight | 25 kDa including tags |
| Sequence | AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 4 subfamily. Contains 1 fibronectin type-III domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation. |
| Function | Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Reconstitute for long term storage. pH: 7.40Constituents: 5% Trehalose, 95% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
