Recombinant Human CD9 Protein (Tagged) (RMPP-00230395)
Cat. No.: RMPP-00230395
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | Q01860 |
|---|---|
| Molecular Weight | 52 kDa including tags |
| Sequence | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFLLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNTSRSEPSGPISTGNPSPPSKESHKSPTDVSLGDELHLDGE DVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMF TDALGIDEYGGLEESGGGGSPGRRRRRRRRRRR |
| Sequence Similarities | Belongs to the POU transcription factor family. Class-5 subfamily. Contains 1 homeobox DNA-binding domain. Contains 1 POU-specific domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. Expressed in a diffuse and slightly punctuate pattern. |
| Tissue Specificity | Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues. |
| Developmental Stage | Highly expressed in undifferentiated embryonic stem cells and expression decreases gradually after embryoid body (EB) formation. |
| Domain | The POU-specific domain mediates interaction with PKM2. |
| Function | Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. |
| Post-translational Modifications | Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20ºC. pH: 8.00Constituents: 1% Potassium chloride, 0.01% DTT, 2% Tris HCl, 0.01% EDTA, 10% Glycerol, 10% Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
