Banner

Recombinant Human DAZL Protein (RMPP-00230057)

Cat. No.: RMPP-00230057

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 2 μg Customer Size

Product Features

Source HEK 293 cells
Purity > 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level < 1.000 Eu/µg
Animal Free No
Tags Fc tag C-Terminus
Form Lyophilized
Applications ELISA; SDS-PAGE
Key Features Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: Fc tag C-Terminus; Suitable for: ELISA, SDS-PAGE

Protein Information

UniProt ID P42081
Molecular Weight 52 kDa including tags
Sequence VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTE KLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIIL QQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLI TNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESM KISSKPLNFTQEFPSPQTYWKE
Sequence Similarities Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Protein Length Protein fragment
Cellular Localization Membrane.
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
Function Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.
Post-translational Modifications Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-ArginineLyophilized from 0.22 µm filtered solution.

For research use only. Not for clinical use.