Banner

Recombinant Human DKK2 Protein (RMPP-00230756)

Cat. No.: RMPP-00230756

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 10 μg 2 μg

Product Features

Source E.coli
Purity > 90% SDS-PAGE.
Nature Recombinant
Animal Free No
Form Liquid
Applications SDS-PAGE; Functional Studies
Key Features Expression system: E.coli; Purity: > 90% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID P01106
Molecular Weight 53 kDa including tags
Sequence MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ QQSELQPPAPSEDIWKKFELLPAPPLSPSRRSGLCSPSYVAVTPFSLRGD NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCAESGGGGSPGRRRRRRRRRRR
Sequence Similarities Contains 1 basic helix-loop-helix (bHLH) domain.
Protein Length Full length protein
Cellular Localization Nucleus > nucleoplasm. Nucleus > nucleolus.
Function Participates in the regulation of gene transcription. Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CACTG-3'. Seems to activate the transcription of growth-related genes.
Involvement in Disease Note=Overexpression of MYC is implicated in the etiology of a variety of hematopoietic tumors.Note=A chromosomal aberration involving MYC may be a cause of a form of B-cell chronic lymphocytic leukemia. Translocation t(8;12)(q24;q22) with BTG1.Defects in MYC are a cause of Burkitt lymphoma (BL). A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass. Note=Chromosomal aberrations involving MYC are usually found in Burkitt lymphoma. Translocations t(8;14), t(8;22) or t(2;8) which juxtapose MYC to one of the heavy or light chain immunoglobulin gene loci.
Post-translational Modifications Phosphorylated by PRKDC. Phosphorylation at Thr-58 and Ser-62 by GSK3 is required for ubiquitination and degradation by the proteasome.Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-58 and Ser-62, leading to its degradation by the proteasome. In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation. In the nucleolus, however, ubiquitination is not counteracted by USP28, due to the lack of interaction between isoform 4 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus. Also polyubiquitinated by the DCX(TRUSS) complex.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
pH: 8.00Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.