Recombinant Human EN2 Protein (RMPP-00230638)
Cat. No.: RMPP-00230638
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Purified by Immobilized metal affinity chromatography. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P06729 |
|---|---|
| Molecular Weight | 23 kDa including tags |
| Molecular Weight Information | The protein has a Calculated MW of 22.3 kDa. The protein migrates as 33-40 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. |
| Sequence | KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKE KETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDL KIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITH KWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLD |
| Sequence Similarities | Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. pH: 7.40Constituents: 95% PBS, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
