Recombinant Human PDGF B Protein (Active) (RMPP-00230123)
Cat. No.: RMPP-00230123
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
10 μg
100 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; WB |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB |
Protein Information
| UniProt ID | P23229 |
|---|---|
| Sequence | FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALP LQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQG PGGKVVTCAH |
| Sequence Similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. Cell membrane. |
| Tissue Specificity | Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotubes, and in a limited number of cell lines; they are always coexpressed with the ubiquitous isoform containing segment X1. In some tissues (e.g. Salivary gland), isoforms containing cytoplasmic segment A and isoforms containing segment B are detected while in others, only isoforms containing one cytoplasmic segment are found (segment A in epidermis and segment B in kidney). |
| Function | Integrin alpha-6/beta-1 is a receptor for laminin on platelets. Integrin alpha-6/beta-4 is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome (By similarity). ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling. |
| Involvement in Disease | Epidermolysis bullosa letalis, with pyloric atresia |
| Post-translational Modifications | Isoforms containing segment A, but not segment B, are the major targets for PMA-induced phosphorylation. Phosphorylation occurs on 'Ser-1103' of isoform alpha-6X1X2A. Phosphorylation is not required for the induction of integrin alpha-6A/beta-1 high affinity but may reduce the affinity for ligand.In invasive prostate cancer ITGA6 undergoes PLAU-mediated cleavage at residues Arg-634-635-Arg in a time-dependent manner enhancing cell invasion and migration in vitro.Palmitoylation by DHHC3 enhances stability and cell surface expression. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
